Download E-books Wirtschaftssysteme: Vergleiche ― Theorie ― Kritik (German Edition) PDF

By Ota Sik

In diesem Buch versuche ich, möglichst leicht verständlich, die bei den heute existierenden Wirtschaftssysteme, das kapitalistisch-marktwirtschaftliche und das sozialistisch-planwirtschaftliche method, in ihren Grundzügen darzustellen und miteinander zu vergleichen. Auch wenn es mir zuerst einmal darum geht, die systembedingte Unterschiedlichkeit der wichtigsten Prozesse, aus welchen sich eine Wirtschaft zusammensetzt, möglichst objektiv näherzubringen, so wird diese Darstellung dennoch immer von meiner Bewertung der Systeme beeinflußt sein. Selbstverständlich geht es um die Bewertung von empirisch erfaßbaren Erschei­ nungen, die mit den Grundzügen dieses oder jenes Wirtschaftssystems inhärent verbunden sind. Meine Einstellung zu beiden Systemen geht davon aus, daß keine Wirtschafts­ bzw. Gesellschaftsordnung von ewiger Dauer ist. Während der geschichtlichen Entwicklung haben sich alle Gesellschaftssysteme verändert und zwar in der Weise, daß sich mehr oder weniger einzelne Systemgrundzüge verändert haben. Es ist meine Überzeugung, daß früher oder später auch verschiedene Grundzüge der heute existierenden Systeme eine Wandlung erfahren werden. Die Völker strebten immer - bewußt oder unbewußt - nach solchen Gesell­ schaftsänderungen, die sie von immer schwerer ertragbaren Leiden, von Ängsten, Unterdrückungen und Krisen befreien sollten. Manchmal dauerte es sehr lange, bevor sie einen richtigen Weg aus ihren Nöten fanden - oft irrten sie auch und folgten falschen Propheten. Trotz solcher Rückschläge setzte sich jedoch langfri­ stig eine fortschreitende Humanisierung der gesellschaftlichen Ordnungen durch.

Show description

Read or Download Wirtschaftssysteme: Vergleiche ― Theorie ― Kritik (German Edition) PDF

Best Business Finance books

Economics: Principles, Problems, & Policies (McGraw-Hill Series in Economics)

McConnell/Brue/Flynn has lengthy set the traditional for delivering high quality content material to teachers and scholars around the globe. It has remained the main general rules of economics product due to chronic innovation. The nineteenth variation introduced adaptive expertise to the marketplace for the 1st time with LearnSmart, a source that guarantees that each minute a pupil spends learning is the best and effective time attainable.

Economics (4th Edition)

Examine economics via actual company examples.

Hubbard/O'Brien explains the fundamentals of economics via demonstrating how actual companies use economics to make actual judgements daily. this can be anything all readers can hook up with, as they stumble upon companies of their day-by-day lives.

And despite destiny profession path—opening an artwork studio, doing social paintings, buying and selling on Wall highway, operating for the govt., or bartending on the neighborhood pub—readers will take advantage of figuring out the commercial forces in the back of their paintings.

Cost-Benefit Analysis (4th Edition) (The Pearson Series in Economics)

A pragmatic advent to cost-benefit research via challenge fixing. This authoritative, market-leading textual content is understood for its constant program of a nine-step framework for accomplishing or analyzing a cost-benefit research. This version encompasses a variety of chapters which have been revised and reorganized to make the cloth clearer and extra available.

Capitalism, Morality & Markets (Readings, 54)

In 2000 the Institute begun a sequence of lectures, endowed by means of Michael Novak and the toilet Templeton beginning, entitled the Templeton discussion board on Markets and Morality. The 4 papers given within the first sequence, and revised through the authors, are incorporated during this quantity. Brian Griffiths considers the company company as an ethical neighborhood, concluding that 'an self reliant ethical normal is not just whatever that's reliable in itself yet is usually within the pursuits of shareholders and employees'.

Additional resources for Wirtschaftssysteme: Vergleiche ― Theorie ― Kritik (German Edition)

Show sample text content

Rated 4.21 of 5 – based on 35 votes